SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E8TQP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E8TQP7
Domain Number 1 Region: 33-177
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.1e-57
Family AadK C-terminal domain-like 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E8TQP7
Sequence length 199
Comment (tr|A0A0E8TQP7|A0A0E8TQP7_STREE) Streptomycin aminoglycoside 6-adenyltransferase {ECO:0000313|EMBL:CRG02960.1} KW=Complete proteome OX=1313 OS=Streptococcus pneumoniae. GN=ERS020521_02385 OC=Streptococcus.
Sequence
MPLEELDNYLKGDKLIKVLIDKDCRIKRDIVPTDIDYHVRKPSAREYDDCCNEFWNVTPY
VIKGLCRKEILFAIDHFNQIVRHELLRMISWKVGIETGFKLSVGKNYKFIERYISEDLWE
KLLSTYRMDSYENIWEALFLCHQLFRAVSGEVAERLHYAYPEYDRNITKYTRDMYKKYTG
KTGCLDSTYAADIEERREQ
Download sequence
Identical sequences A0A0E1AI93 A0A0E8TQP7 A0A224B0S7
gi|554644886|ref|YP_008716677.1| gi|385780357|ref|YP_005756528.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]