SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E8XHP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E8XHP5
Domain Number - Region: 29-112
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000419
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E8XHP5
Sequence length 194
Comment (tr|A0A0E8XHP5|A0A0E8XHP5_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:CRG50233.1} KW=Complete proteome OX=1341643 OS=Yersinia wautersii. GN=ERS008478_01793 OC=Yersiniaceae; Yersinia.
Sequence
MANIYERNIPERIATFIQFAEKNPDFSTIFIVTSSDDEGLTYWIDSYDENGADHHIAKRD
LIQFCEADMGGSHFCFWDDGQGKSLDEMPVVVAGNEGDFPIVARNFDELLSLMSLGEELY
LHGDEASCCNFDGSTQEPEFFEFLTFLEKTLNITPLKTADEGNAIITQARLAFLDEFNLW
VNKALKGVDSENQK
Download sequence
Identical sequences A0A0E1NT06 A0A0E8XHP5 A0A0H2W727 A0A0H2YH08 A0A0H3B2A0 A0A0M1VDP6 A0A0U1ESQ5 A0A0U1R1I1 A0A208S7P9 A0A2A7VHW5 Q668H4 Q7CJI3
gi|45442443|ref|NP_993982.1| gi|108808229|ref|YP_652145.1| gi|22125336|ref|NP_668759.1| gi|384139110|ref|YP_005521812.1| gi|108811504|ref|YP_647271.1| gi|162419558|ref|YP_001607513.1| gi|51597082|ref|YP_071273.1| gi|384123257|ref|YP_005505877.1| 187410.y1438 214092.YPO3044 229193.YP_2667 273123.YPTB2766 349746.YpAngola_A3151 349747.YpsIP31758_1267 360102.YPA_2235 377628.YPN_1341 386656.YPDSF_2149 502800.YPK_1381 502801.YPTS_2870 gi|384413892|ref|YP_005623254.1| gi|153950104|ref|YP_001400247.1| gi|218930089|ref|YP_002347964.1| gi|145599423|ref|YP_001163499.1| gi|384127113|ref|YP_005509727.1| gi|186896172|ref|YP_001873284.1| WP_002208540.1.100083 WP_002208540.1.100593 WP_002208540.1.10066 WP_002208540.1.100921 WP_002208540.1.10105 WP_002208540.1.101305 WP_002208540.1.101382 WP_002208540.1.101928 WP_002208540.1.102012 WP_002208540.1.102067 WP_002208540.1.10736 WP_002208540.1.10935 WP_002208540.1.10955 WP_002208540.1.11693 WP_002208540.1.12463 WP_002208540.1.12857 WP_002208540.1.1388 WP_002208540.1.14063 WP_002208540.1.14169 WP_002208540.1.15321 WP_002208540.1.15555 WP_002208540.1.15605 WP_002208540.1.15689 WP_002208540.1.16243 WP_002208540.1.16333 WP_002208540.1.17135 WP_002208540.1.17141 WP_002208540.1.17608 WP_002208540.1.17873 WP_002208540.1.17983 WP_002208540.1.18208 WP_002208540.1.18640 WP_002208540.1.18826 WP_002208540.1.19329 WP_002208540.1.19425 WP_002208540.1.19739 WP_002208540.1.19763 WP_002208540.1.20380 WP_002208540.1.20547 WP_002208540.1.2064 WP_002208540.1.20932 WP_002208540.1.21486 WP_002208540.1.21784 WP_002208540.1.21879 WP_002208540.1.21934 WP_002208540.1.22530 WP_002208540.1.22542 WP_002208540.1.23157 WP_002208540.1.23271 WP_002208540.1.23687 WP_002208540.1.23811 WP_002208540.1.24002 WP_002208540.1.2451 WP_002208540.1.24517 WP_002208540.1.25181 WP_002208540.1.25394 WP_002208540.1.26383 WP_002208540.1.2640 WP_002208540.1.26509 WP_002208540.1.26960 WP_002208540.1.27124 WP_002208540.1.27251 WP_002208540.1.2726 WP_002208540.1.28647 WP_002208540.1.29157 WP_002208540.1.29186 WP_002208540.1.29355 WP_002208540.1.2947 WP_002208540.1.29622 WP_002208540.1.2964 WP_002208540.1.29685 WP_002208540.1.29814 WP_002208540.1.3092 WP_002208540.1.30931 WP_002208540.1.311 WP_002208540.1.31336 WP_002208540.1.31496 WP_002208540.1.31721 WP_002208540.1.31739 WP_002208540.1.31805 WP_002208540.1.32343 WP_002208540.1.32446 WP_002208540.1.32736 WP_002208540.1.33324 WP_002208540.1.33661 WP_002208540.1.33775 WP_002208540.1.33937 WP_002208540.1.34031 WP_002208540.1.34138 WP_002208540.1.35389 WP_002208540.1.35538 WP_002208540.1.36088 WP_002208540.1.37174 WP_002208540.1.37494 WP_002208540.1.37863 WP_002208540.1.38235 WP_002208540.1.38532 WP_002208540.1.38743 WP_002208540.1.38824 WP_002208540.1.38993 WP_002208540.1.39066 WP_002208540.1.3976 WP_002208540.1.39858 WP_002208540.1.40071 WP_002208540.1.40134 WP_002208540.1.40534 WP_002208540.1.40853 WP_002208540.1.41196 WP_002208540.1.4210 WP_002208540.1.42361 WP_002208540.1.42490 WP_002208540.1.42976 WP_002208540.1.44408 WP_002208540.1.44832 WP_002208540.1.45198 WP_002208540.1.45214 WP_002208540.1.46262 WP_002208540.1.46545 WP_002208540.1.46686 WP_002208540.1.46697 WP_002208540.1.46731 WP_002208540.1.4678 WP_002208540.1.46891 WP_002208540.1.47387 WP_002208540.1.47440 WP_002208540.1.47769 WP_002208540.1.47881 WP_002208540.1.48722 WP_002208540.1.49315 WP_002208540.1.49906 WP_002208540.1.4997 WP_002208540.1.50010 WP_002208540.1.50093 WP_002208540.1.50185 WP_002208540.1.50984 WP_002208540.1.51284 WP_002208540.1.51293 WP_002208540.1.51588 WP_002208540.1.51772 WP_002208540.1.51934 WP_002208540.1.52158 WP_002208540.1.52247 WP_002208540.1.52473 WP_002208540.1.52569 WP_002208540.1.52734 WP_002208540.1.52792 WP_002208540.1.52819 WP_002208540.1.53147 WP_002208540.1.53838 WP_002208540.1.53848 WP_002208540.1.53883 WP_002208540.1.53953 WP_002208540.1.54568 WP_002208540.1.54951 WP_002208540.1.55194 WP_002208540.1.5592 WP_002208540.1.56031 WP_002208540.1.56912 WP_002208540.1.57585 WP_002208540.1.57657 WP_002208540.1.58067 WP_002208540.1.58543 WP_002208540.1.58794 WP_002208540.1.59102 WP_002208540.1.59431 WP_002208540.1.5957 WP_002208540.1.59635 WP_002208540.1.5968 WP_002208540.1.59789 WP_002208540.1.59885 WP_002208540.1.60437 WP_002208540.1.60707 WP_002208540.1.60896 WP_002208540.1.62232 WP_002208540.1.62342 WP_002208540.1.6270 WP_002208540.1.6333 WP_002208540.1.63387 WP_002208540.1.63517 WP_002208540.1.63641 WP_002208540.1.64142 WP_002208540.1.64474 WP_002208540.1.64780 WP_002208540.1.64786 WP_002208540.1.64910 WP_002208540.1.653 WP_002208540.1.65554 WP_002208540.1.6570 WP_002208540.1.65706 WP_002208540.1.65718 WP_002208540.1.6581 WP_002208540.1.66118 WP_002208540.1.66546 WP_002208540.1.66616 WP_002208540.1.67404 WP_002208540.1.67850 WP_002208540.1.6791 WP_002208540.1.68361 WP_002208540.1.68371 WP_002208540.1.68753 WP_002208540.1.68855 WP_002208540.1.69018 WP_002208540.1.69316 WP_002208540.1.69951 WP_002208540.1.70117 WP_002208540.1.70171 WP_002208540.1.70319 WP_002208540.1.70377 WP_002208540.1.70417 WP_002208540.1.70726 WP_002208540.1.7083 WP_002208540.1.7169 WP_002208540.1.71744 WP_002208540.1.72280 WP_002208540.1.72440 WP_002208540.1.72486 WP_002208540.1.7402 WP_002208540.1.74131 WP_002208540.1.74310 WP_002208540.1.74577 WP_002208540.1.74738 WP_002208540.1.75169 WP_002208540.1.7518 WP_002208540.1.75208 WP_002208540.1.75337 WP_002208540.1.75407 WP_002208540.1.75636 WP_002208540.1.76555 WP_002208540.1.76670 WP_002208540.1.77295 WP_002208540.1.77387 WP_002208540.1.77429 WP_002208540.1.77569 WP_002208540.1.77691 WP_002208540.1.78004 WP_002208540.1.7841 WP_002208540.1.78556 WP_002208540.1.79825 WP_002208540.1.79981 WP_002208540.1.8009 WP_002208540.1.80331 WP_002208540.1.81848 WP_002208540.1.81877 WP_002208540.1.8210 WP_002208540.1.82133 WP_002208540.1.82151 WP_002208540.1.82270 WP_002208540.1.82436 WP_002208540.1.82619 WP_002208540.1.8303 WP_002208540.1.83039 WP_002208540.1.83265 WP_002208540.1.83630 WP_002208540.1.8420 WP_002208540.1.84703 WP_002208540.1.84720 WP_002208540.1.85270 WP_002208540.1.8559 WP_002208540.1.85802 WP_002208540.1.86034 WP_002208540.1.86059 WP_002208540.1.86413 WP_002208540.1.87107 WP_002208540.1.8728 WP_002208540.1.87418 WP_002208540.1.8762 WP_002208540.1.87853 WP_002208540.1.87988 WP_002208540.1.88362 WP_002208540.1.88472 WP_002208540.1.89359 WP_002208540.1.89542 WP_002208540.1.8964 WP_002208540.1.90176 WP_002208540.1.9051 WP_002208540.1.90624 WP_002208540.1.91373 WP_002208540.1.91844 WP_002208540.1.92030 WP_002208540.1.92331 WP_002208540.1.927 WP_002208540.1.9311 WP_002208540.1.9320 WP_002208540.1.93623 WP_002208540.1.93928 WP_002208540.1.94052 WP_002208540.1.94201 WP_002208540.1.94545 WP_002208540.1.94683 WP_002208540.1.95981 WP_002208540.1.97245 WP_002208540.1.97375 WP_002208540.1.97448 WP_002208540.1.97791 WP_002208540.1.97894 WP_002208540.1.99109 WP_002208540.1.99383 WP_002208540.1.9941 WP_002208540.1.99882 WP_002208540.1.99972 WP_002208540.1.99990 YP_002347964.1.25044 gi|294504791|ref|YP_003568853.1| gi|170023623|ref|YP_001720128.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]