SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E8XN55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E8XN55
Domain Number 1 Region: 53-141
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000147
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E8XN55
Sequence length 158
Comment (tr|A0A0E8XN55|A0A0E8XN55_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:CRG50787.1} KW=Complete proteome OX=1341643 OS=Yersinia wautersii. GN=ERS008478_02384 OC=Yersiniaceae; Yersinia.
Sequence
MNTENKTLITLIDKIHTIAKSRLAAGYEDRDGINEHQVTPCHHALTLLGGDDFADSYLPF
LRNVNGFDLNGVRLFGYFDDKDDERDLRKQLADLKAVPELFPDAFNDWVLIGETDTDILI
FNKKNGAYENRDRIGLDRLNESYDDIVGLLISLMPLIE
Download sequence
Identical sequences A0A0E8XN55
WP_033850344.1.26509 WP_033850344.1.52569 WP_033850344.1.63517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]