SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9EGA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9EGA3
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000327
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E9EGA3
Sequence length 115
Comment (tr|A0A0E9EGA3|A0A0E9EGA3_CHLTH) Uncharacterized protein {ECO:0000313|EMBL:CRH69279.1} OX=813 OS=Chlamydia trachomatis. GN=ERS095036_04117 OC=Chlamydia/Chlamydophila group; Chlamydia.
Sequence
MNKEFNFEFPTIYREFLSQIDKEGEFLIENTGVVLYSKIDLEERNTTYQIEEWEPDFFLI
GQDGDRAFFIKKYSDDTIYMNDLGVLGSFEMKRILASIYEFINYTREHYDEMLQL
Download sequence
Identical sequences A0A0E9EGA3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]