SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9F615 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9F615
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.67e-41
Family AadK C-terminal domain-like 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E9F615
Sequence length 135
Comment (tr|A0A0E9F615|A0A0E9F615_CHLTH) Aminoglycoside 6-adenylyltransferase {ECO:0000313|EMBL:CRH78147.1} OX=813 OS=Chlamydia trachomatis. GN=ERS095036_11278 OC=Chlamydia/Chlamydophila group; Chlamydia.
Sequence
MCRKEILFAIDHFNQIVRHELLRMISWKVGIETGFKLSVGKNYKFIERYISEDLWEKLLS
TYRMDSYENIWEALFLCHQLFRAVSGEVAERLHYAYPEYDRNITKYTRDMYKKYTGKTGC
LDSTYAADIEERREQ
Download sequence
Identical sequences A0A0E9F615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]