SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9FBZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9FBZ2
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 5.57e-31
Family AadK C-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E9FBZ2
Sequence length 96
Comment (tr|A0A0E9FBZ2|A0A0E9FBZ2_CHLTH) Aminoglycoside 6-adenylyltransferase {ECO:0000313|EMBL:CRH80212.1} OX=813 OS=Chlamydia trachomatis. GN=ERS095036_13279 OC=Chlamydia/Chlamydophila group; Chlamydia.
Sequence
MSWKVGIKTEFSLSVGKNYKYINKYIDEDLWNRLLSTYRMDSYENIWKSLFICHQLFREV
SKEVAELLGFDYPEYGKNITRYTEDMYKKYVENDYF
Download sequence
Identical sequences A0A0E9FBZ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]