SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9H1L3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9H1L3
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily YugE-like 3.53e-24
Family YugE-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E9H1L3
Sequence length 70
Comment (tr|A0A0E9H1L3|A0A0E9H1L3_STREE) Domain of uncharacterized function (DUF1871) {ECO:0000313|EMBL:CRI00563.1} KW=Complete proteome OX=1313 OS=Streptococcus pneumoniae. GN=ERS232508_02719 OC=Streptococcus.
Sequence
MGTYEKMIEVVKNWDPFQMGPEFYETEASDVVNVISVFDDPKYIAKKIQHIYFMSFEEVP
ALEKCEKLAV
Download sequence
Identical sequences A0A0E9H1L3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]