SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9LK73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0E9LK73
Domain Number - Region: 32-59
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0965
Family Cytochrome c oxidase Subunit F 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E9LK73
Sequence length 68
Comment (tr|A0A0E9LK73|A0A0E9LK73_9BURK) Zinc finger {ECO:0000313|EMBL:GAO25977.1} KW=Complete proteome OX=1603291 OS=Alicycliphilus sp. B1. GN=ALISP_5797 OC=Comamonadaceae; Alicycliphilus.
Sequence
MPQAIVELLAKDLDGNGGVHCPNPKADMKLWNGHPRVFLEIAHQGQAQCPYCGTLYRLKA
GEIVHAGH
Download sequence
Identical sequences A0A0E9LK73 A0A255QFB5 E8TTX6 F4GEG0
gi|330822888|ref|YP_004386191.1| WP_013517214.1.1403 WP_013517214.1.61486 WP_013517214.1.73355 WP_013517214.1.74306 gi|319761030|ref|YP_004124967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]