SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9N6G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9N6G7
Domain Number 1 Region: 12-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000301
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E9N6G7
Sequence length 155
Comment (tr|A0A0E9N6G7|A0A0E9N6G7_9BACT) Uncharacterized protein {ECO:0000313|EMBL:GAO45383.1} KW=Complete proteome; Reference proteome OX=1220578 OS=Flavihumibacter petaseus NBRC 106054. GN=FPE01S_05_00800 OC=Chitinophagaceae; Flavihumibacter.
Sequence
MQITIIEILPQIGKKGKPLSDGELVSFEKSSGVCIPEDLKEYFNYLGQSQMTYNDELYQF
RTLKNFETVNKNLVNFRGLPDFGNLFYTLPSYKNCFVIADYMFHMFAYLIRLYPEPTDHN
EIYIVCGDRHQIIANSFTEFLRLYDINSVTMMFSE
Download sequence
Identical sequences A0A0E9N6G7
WP_046371400.1.6184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]