SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9XH77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9XH77
Domain Number 1 Region: 12-114
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 7.32e-23
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0E9XH77
Sequence length 121
Comment (tr|A0A0E9XH77|A0A0E9XH77_ANGAN) Uncharacterized protein {ECO:0000313|EMBL:JAI01201.1} OX=7936 OS=Anguilla anguilla (European freshwater eel) (Muraena anguilla). GN= OC=Anguilla.
Sequence
MDIHLVPEGPKDIPCFTSRNQSTLGELLLGFLKYYGSVFNWDRSVISVREAEAFPKSNCR
EWRDKFICVEEPFDRTNTARAVHERFKFDTIKEEFRKSWQMLQLKKDLNFILPVRTTIQK
R
Download sequence
Identical sequences A0A0E9XH77

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]