SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9XZU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9XZU2
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily TIMP-like 2.28e-20
Family Netrin-like domain (NTR/C345C module) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E9XZU2
Sequence length 79
Comment (tr|A0A0E9XZU2|A0A0E9XZU2_ANGAN) Uncharacterized protein {ECO:0000313|EMBL:JAI08175.1} OX=7936 OS=Anguilla anguilla (European freshwater eel) (Muraena anguilla). GN= OC=Anguilla.
Sequence
MAHPYCRESIALREGKTYLIMGKSDDLIKDKDGMMYMLGEGTWIEYWPTEPECQQPAFRE
PCLGIKEATADLVTYGCPT
Download sequence
Identical sequences A0A0E9XZU2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]