SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9Y2S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9Y2S5
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily Serpins 5.24e-21
Family Serpins 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E9Y2S5
Sequence length 71
Comment (tr|A0A0E9Y2S5|A0A0E9Y2S5_AMBAM) Serine protease inhibitor {ECO:0000313|EMBL:JAI08646.1} OX=6943 OS=Amblyomma americanum (Lone star tick). GN= OC=Amblyomma.
Sequence
MAASEVIHKALVEVDEEGTEAAAATAVTVVDGCMPRAPQVTYKFVVDRPFLFLIRSHDPE
VVLFMGSVREL
Download sequence
Identical sequences A0A0E9Y2S5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]