SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E9Y363 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E9Y363
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Serpins 0.00000000000209
Family Serpins 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E9Y363
Sequence length 91
Comment (tr|A0A0E9Y363|A0A0E9Y363_AMBAM) Serine protease inhibitor {ECO:0000313|EMBL:JAI08951.1} OX=6943 OS=Amblyomma americanum (Lone star tick). GN= OC=Amblyomma.
Sequence
MAYAGARGETQQELYDSLAYSSAGLAPDHVPNAHAQHTQALKSPSSSTLLVANTAVVQEG
YNVLREYLQTLNQSFSAEVSTTNLADEQSLR
Download sequence
Identical sequences A0A0E9Y363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]