SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F0C7C1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F0C7C1
Domain Number - Region: 4-34
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0424
Family Rubredoxin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F0C7C1
Sequence length 156
Comment (tr|A0A0F0C7C1|A0A0F0C7C1_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:KJJ66076.1} KW=Complete proteome; Reference proteome OX=1609975 OS=Clostridium sp. FS41. GN=CLFS41_53150 OC=Clostridium.
Sequence
MRELAVFYCPKCGHYAYYQTSRHPQCPKCGCAEAMNMVRMHYTEFMRMSCDERDEYLSKE
ILRTNPSLVERLTEPHKRYNSREIIAEMNNVIMNLDTENKILNDTVKWMHDTIWDLIHER
RHLLRDEAAATDISPEQEEAEGQEHVCIREIMQDKA
Download sequence
Identical sequences A0A0F0C7C1 A0A0J9CIK9 A0A1C5ZZW5 G5HRR2
WP_007869410.1.54606 WP_007869410.1.73368 WP_007869410.1.88818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]