SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F0DVH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0DVH0
Domain Number 1 Region: 36-259
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 1.18e-60
Family Chemotaxis phosphatase CheZ 0.0000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F0DVH0
Sequence length 260
Comment (tr|A0A0F0DVH0|A0A0F0DVH0_9PSED) Chemotaxis protein CheZ {ECO:0000256|PIRNR:PIRNR002884} KW=Complete proteome OX=1619948 OS=Pseudomonas sp. 21. GN=UB43_14370 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MDFNESAGDFESTLKKHARELVDCLEQGDVQTAVQLISELNQARDRGLYQEVGKLTRELH
NAIVNFQIDPSSPRAQEVSQIADATDRLSYVVTMTEKAANRTMDLVEECTPVVMHIETQA
KELQEDWSRFMRRELGPEAFRDLAKRVEQFLYISAQDSRKLSAHLNDILLAQDFQDLTGQ
VIKRVTKLVTEVESNLVKLVWMAGQVDRYAGIEHDHESMRDAVEKERSSKGEGPQIAADT
RKDVVSGQDDVDDLLSSLGF
Download sequence
Identical sequences A0A0F0DVH0 A0A1V9UN53
WP_045212054.1.11767 WP_045212054.1.45794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]