SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F0EYH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0EYH3
Domain Number 1 Region: 70-147
Classification Level Classification E-value
Superfamily CalX-like 0.0000902
Family CalX-beta domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F0EYH3
Sequence length 168
Comment (tr|A0A0F0EYH3|A0A0F0EYH3_9PSED) Uncharacterized protein {ECO:0000313|EMBL:KJK13146.1} KW=Complete proteome OX=1619950 OS=Pseudomonas sp. 2(2015). GN=UB48_26775 OC=Pseudomonadaceae; Pseudomonas.
Sequence
QQITIPVGSSTGTVDFVAPNNVHTTNPDLTNSITGTTGGNYEKLDTAGNPVTTVTDGPGT
DDTTSLKLTATPTVNEGGSITYTATLTNPAGTEMKVTLSNGEXXXVITIAKGQTEGKITI
DAPSDDVYIDADKLSVTVTGTTGGDFEKLAVDNTPAVTDVKDTIDTST
Download sequence
Identical sequences A0A0F0EYH3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]