SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F0FJ84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0FJ84
Domain Number 1 Region: 248-313
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000955
Family Pseudo ankyrin repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F0FJ84
Sequence length 417
Comment (tr|A0A0F0FJ84|A0A0F0FJ84_9PSED) Uncharacterized protein {ECO:0000313|EMBL:KJK20296.1} KW=Complete proteome OX=1619950 OS=Pseudomonas sp. 2(2015). GN=UB48_00720 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MELSPAEHQLLQDHHLALFEGCVIFDTQPAIDAATLARIEAQLSGPLPAGLLQLWQTCLG
GRVGYDLEVVYDGHRHPFSFSELFYPDSDGYRDLWGWIEHEQEQAEEAAREHGRPWNGKL
DYLPFGGFEYLERLYVCVTPGPNHGAVIAWSRGLPPAWAGSLHQDSLARIADDIAGLFHL
LAYEQDPFDPQAEYSSASELLEALDELQAAGESGVTLKARLETLLRERVLDWRPALADGS
LAGQPRLRQLALLDAASHGDIERLAALRRAGCDLSETLRGHGASLECCLQHGHLEAASWL
LDQGMPVQADTLLVGAAQVTPALAKRLLGLGAISEPSAVLSAIAQDHLDSAEIMARPLLE
ASPDSASALQKALLERAEQQRRDAKRIKAGTLYSNLSAADYLAEAERIDALRQRLFN
Download sequence
Identical sequences A0A0F0FJ84
WP_045193527.1.36947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]