SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F0FVH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0FVH9
Domain Number 1 Region: 8-161
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 9.42e-62
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F0FVH9
Sequence length 165
Comment (tr|A0A0F0FVH9|A0A0F0FVH9_9BURK) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=1619952 OS=Burkholderiaceae bacterium 16. GN=UB46_10265 OC=Burkholderiaceae.
Sequence
MSNTAKPLVGVVMGSSSDWDVMQNAVAMLKDFGVAFEARVVSAHRMADDMFEYAATARER
GLRAIIAGAGGAAHLPGMIAAKTIVPVFGVPVPSRYLRGEDSLLSIVQMPKGVPVATFAI
GEAGAANAALHAIATLATTDDALAAALEAFRARQTEAARAMTLPV
Download sequence
Identical sequences A0A069IFV1 A0A0F0FVH9
WP_035869268.1.47822 WP_035869268.1.6995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]