SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F0GF14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0GF14
Domain Number 1 Region: 1-56,83-174
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000101
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F0GF14
Sequence length 196
Comment (tr|A0A0F0GF14|A0A0F0GF14_NOCAE) Uncharacterized protein {ECO:0000313|EMBL:KJK41965.1} KW=Complete proteome; Reference proteome OX=68170 OS=(Saccharothrix aerocolonigenes). GN=UK23_39550 OC=Lechevalieria.
Sequence
MSWTGIESWVRATSPTLHAALRPPATDSDIASAEESLGLLLPPELVAWWQQFGGIAQTYR
RWPLIPPHWQPLGLDGALRLRKVMIDAISGIHFATRGEEKDFEAAALREPAGTPCVELWL
PAWLPVATDGLGYWLFVDLRGGEQYACVMEWDKYSGADREPVWPGVTAMLEETVRALSGD
HEQHRLVFEHNDFFWE
Download sequence
Identical sequences A0A0F0GF14
WP_045316922.1.38650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]