SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F0H6Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0H6Z4
Domain Number 1 Region: 56-116
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000049
Family SMI1/KNR4-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F0H6Z4
Sequence length 154
Comment (tr|A0A0F0H6Z4|A0A0F0H6Z4_NOCAE) Uncharacterized protein {ECO:0000313|EMBL:KJK49393.1} KW=Complete proteome; Reference proteome OX=68170 OS=(Saccharothrix aerocolonigenes). GN=UK23_13915 OC=Lechevalieria.
Sequence
MAFPADLVALWRQDGIDAGWWLPPECGFALEEPDEALATWAILLQVAEEEDPDDPMWPDR
FTPDLFPIAMNSGGDSLVVDLRPGEHRGAVHFWDHEEWGLDEPLWPGVGAMLADIADALE
AGGPALTWHAARGGRQRPCAPIVNHQNEFEGWQS
Download sequence
Identical sequences A0A0F0H6Z4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]