SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F0IFB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0IFB5
Domain Number 1 Region: 55-194
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.13e-24
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F0IFB5
Sequence length 364
Comment (tr|A0A0F0IFB5|A0A0F0IFB5_ASPPU) Regulator of G protein signaling domain protein {ECO:0000313|EMBL:KJK64508.1} KW=Complete proteome; Reference proteome OX=1403190 OS=SU-1). GN=P875_00011250 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MLKKKTLYPPLHFWHSTPTSTPELSPTSSSSDSESDEDMDLSGSRPLSLTVPAGAFCPMR
PTLDEVLANTAPAPYTLSAFMAYLSQNHCLETLEFTLEAKRYRETYDTLSQQLGEYPIGT
ECPESQHLRMLWQRLLTAYIIPGSPREINVSSEVRDDILRQANSTIPPLPETLDAAVKLV
HELMEESIFLPFLNAHSASAQVVPLAEPLFPQEDGVTVVAGPGLDEHAMKRARSKGRRLS
PRSSKDFGSPTYSSSHSGRSNFSLSAMTSMGKSSHRHSSHTSSGSGECSAGLTDDSGSLQ
SMSTSEPMTPPTTPPSSDAHGLHLAHSPKQRTDNPWKKMGMKLGFKKRSTTGSSGSNKLS
GTDE
Download sequence
Identical sequences A0A0F0IFB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]