SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F0LSB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0LSB9
Domain Number 1 Region: 42-104
Classification Level Classification E-value
Superfamily YdhG-like 0.00000017
Family YdhG-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F0LSB9
Sequence length 147
Comment (tr|A0A0F0LSB9|A0A0F0LSB9_9MICO) Uncharacterized protein {ECO:0000313|EMBL:KJL36028.1} KW=Complete proteome; Reference proteome OX=400772 OS=Microbacterium ginsengisoli. GN=RR49_02075 OC=Microbacterium.
Sequence
MTPSDETFSAEERAAMKEAAAEKRTAAKRAKDADKAAAELQDVIDKIATFSDFDRPLAEK
VHEIVTTVAPQLAPKLWYGMPSYANAEGKSVLFFKDAAKFKDHYATLGFQATAHLDEGTF
WAKEFAITAIDDAVAAQIAELVRRAVS
Download sequence
Identical sequences A0A0F0LSB9
WP_045247980.1.38867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]