SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F0LSJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0LSJ1
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 8.72e-32
Family Ribosomal L27 protein 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F0LSJ1
Sequence length 85
Comment (tr|A0A0F0LSJ1|A0A0F0LSJ1_9MICO) 50S ribosomal protein L27 {ECO:0000256|HAMAP-Rule:MF_00539} KW=Complete proteome; Reference proteome OX=400772 OS=Microbacterium ginsengisoli. GN=RR49_02444 OC=Microbacterium.
Sequence
MAHKKGASSTRNGRDSNAQRLGVKRFGGQVVNAGEIIVRQRGTHFHPGVNVGRGGDDTLF
ALSAGAVEFGTKGGRKVVNIVASAE
Download sequence
Identical sequences A0A0F0LSJ1 A0A1M3B2P9
WP_045248359.1.30821 WP_045248359.1.33922 WP_045248359.1.38867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]