SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F0U161 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F0U161
Domain Number 1 Region: 64-164
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000262
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F0U161
Sequence length 166
Comment (tr|A0A0F0U161|A0A0F0U161_ENTCL) Uncharacterized protein {ECO:0000313|EMBL:KJM41297.1} KW=Complete proteome OX=336306 OS=Enterobacter cloacae subsp. cloacae. GN=SS44_01785 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MKMKSNVTDLLIELRKMMTDLEYPVQQPINTSFLDSLTKGPRNTASPILDQIGNETCLLL
ANQPDYTTFIKTMDGFEYNGLTMFSLSIPEPIVKNLFIMNEFYRNNDYLDPELQERLVIG
EDGMSLFTYDTKMNLFEIRDNASTESIYGSFDNFNDFLSEIVDSVK
Download sequence
Identical sequences A0A0F0U161
WP_040020551.1.13165 WP_040020551.1.40063 WP_040020551.1.67678 WP_040020551.1.8463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]