SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F1AZF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F1AZF4
Domain Number 1 Region: 19-135
Classification Level Classification E-value
Superfamily PapD-like 7.33e-24
Family Pilus chaperone 0.0055
Further Details:      
 
Domain Number 2 Region: 140-222
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.000000000249
Family Periplasmic chaperone C-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F1AZF4
Sequence length 228
Comment (tr|A0A0F1AZF4|A0A0F1AZF4_9ENTR) Molecular chaperone {ECO:0000313|EMBL:KJN26459.1} KW=Complete proteome OX=1619248 OS=Enterobacter cloacae complex sp. 35699. GN=SS37_12295 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MLLLKRTLICACLLASFNTLAAGMVPETPLLIVKEDEQGASMDVKNTDADAQLLYTKLVD
LPDDPKPGLIVTQPVVRVDAGKTQRVRFVLKNSAEPLKVEHIKRVIFTAIPQREKNKVKV
AFSQNLPVIIRPAGLAVNLEPWKDLTWQMNNGNVTVENKTPYVVRMEQKAKLLPSGTTVQ
FAKTYILPGEKMTASAKTKITSAEKQIEIYPVSRYGYQVQSYLTDLKE
Download sequence
Identical sequences A0A0F1AZF4
WP_045285701.1.69892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]