SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2CSW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2CSW9
Domain Number 1 Region: 128-270
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 7.69e-47
Family AadK C-terminal domain-like 0.0000863
Further Details:      
 
Domain Number 2 Region: 1-123
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.62e-36
Family AadK N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2CSW9
Sequence length 275
Comment (tr|A0A0F2CSW9|A0A0F2CSW9_STRCR) Streptomycin adenylyltransferase {ECO:0000313|EMBL:KJQ61922.1} KW=Complete proteome OX=45634 OS=Streptococcus cristatus. GN=TW70_00077 OC=Streptococcus.
Sequence
MRTESEMFDVILQTAKVLQVNAVAMSGSRTNPNAPKDEFQDYDVVYIVEDLDGLTADLAW
LERFGKRIIEQHNLLDHRRLYLMLFEDGNRIDLTLCPKEHIKEWVNSEADFTVLDDTQGL
FESYAPTPKRYWTAPASATDFYKSCNEFWWVSAYVVKGIYRNHLVYATDHLYGICQQELL
KILAWQVAADKGTVDVGKNYKYLFQYLPAEKGKEFTALLDFSEQKSLTKSLLATMDFFHK
EAQDFSLKTGFPYDKETAEKMIEYAEERVKKFGNN
Download sequence
Identical sequences A0A0F2CSW9
WP_045496640.1.57833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]