SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2CU13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2CU13
Domain Number 1 Region: 7-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.59e-18
Family SMI1/KNR4-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2CU13
Sequence length 151
Comment (tr|A0A0F2CU13|A0A0F2CU13_STRCR) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KJQ62312.1} KW=Complete proteome OX=45634 OS=Streptococcus cristatus. GN=TW70_00470 OC=Streptococcus.
Sequence
MSLMIRPLGHASDQEIKDLEEKYMLTLPEDYKNFLKENNGGRCPSYEFENSIEIKNINEE
INVAVLYGIKTGVKNSDIEEWTDEYLDDLFSNSIIIGDSLQHGFLIFWLSGDEDEGIYYY
DDTYNLEASSDENNAYFLARTFTEFLELVQN
Download sequence
Identical sequences A0A0F2CU13
WP_045497596.1.57833 WP_045497596.1.73586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]