SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2DV12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2DV12
Domain Number 1 Region: 21-164
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.01e-17
Family SMI1/KNR4-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2DV12
Sequence length 166
Comment (tr|A0A0F2DV12|A0A0F2DV12_9STRE) Immunity protein RhsIB {ECO:0000313|EMBL:KJQ73994.1} KW=Complete proteome OX=68892 OS=Streptococcus infantis. GN=TZ94_01515 OC=Streptococcus.
Sequence
MDNFKKILVDIQDLIKSSNGNLINYGKSNFIFKKRYDVSLDEINDFEKNFKVTFPRIYRE
FLLTVGSCTLFQDELLPGFDFLAPKELYDWSQQVFEGTDCNLFPNILITISIPRTGDQAG
FLLTKENENFGVFFPDIPPEEWEEDTEFEKFEDWLENLMKEKLEEI
Download sequence
Identical sequences A0A0F2DV12
WP_045615685.1.22862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]