SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2DYX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2DYX7
Domain Number 1 Region: 127-268
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.02e-49
Family AadK C-terminal domain-like 0.0000964
Further Details:      
 
Domain Number 2 Region: 1-123
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.41e-37
Family AadK N-terminal domain-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F2DYX7
Sequence length 273
Comment (tr|A0A0F2DYX7|A0A0F2DYX7_9STRE) Streptomycin adenylyltransferase {ECO:0000313|EMBL:KJQ75389.1} KW=Complete proteome OX=68892 OS=Streptococcus infantis. GN=TZ94_01154 OC=Streptococcus.
Sequence
MRTDQEMLDLILQIAKKLQVDAVALSGSRTNQKIQTDEFQDYDVVYIVDDLDNLTSNLSW
LDQFGKRIVEQEVTLGHRRLYLMLFEDGNRIDLTLCPKVHINEWVDSEAGFIVLVDDKGL
FGSYSSSPERFWIHPASETDFEKSCNEFWWVSAYVVKGICRKQVIYATDHLYGICQQELL
KILAWQVARDRGAVDIGKNYKYLFNYLPSEKEKAFSNLLDFSSLDKIIQSLLATMQLFHQ
EAQRLAKKMGFDYDREVAEKMIQYAEEKLQSTK
Download sequence
Identical sequences A0A0F2DYX7
WP_045615109.1.22862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]