SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2DZ23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2DZ23
Domain Number 1 Region: 14-116
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000536
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F2DZ23
Sequence length 119
Comment (tr|A0A0F2DZ23|A0A0F2DZ23_9STRE) Uncharacterized protein {ECO:0000313|EMBL:KJQ75429.1} KW=Complete proteome OX=68892 OS=Streptococcus infantis. GN=TZ94_01194 OC=Streptococcus.
Sequence
MKNYLLDERIFQYPESFKKLIELNLVDFDCWYLLDSEWALSLYKGLQERYPSRKLIPFAK
RGDCDDTACFEIGKGNKVQLIHDFAAEGWEQRKEFNDFWEWVEYAVKCMIEYNKEDGIE
Download sequence
Identical sequences A0A0F2DZ23
WP_045615162.1.22862 WP_045615162.1.58370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]