SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2E0Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2E0Y9
Domain Number 1 Region: 9-139
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000051
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F2E0Y9
Sequence length 139
Comment (tr|A0A0F2E0Y9|A0A0F2E0Y9_9STRE) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KJQ75446.1} KW=Complete proteome OX=68892 OS=Streptococcus infantis. GN=TZ94_01211 OC=Streptococcus.
Sequence
MFRMLDEDSPISKEDLLQFEEILGKKLPKTMMDFYVKYNGGQPQVRGVHDDRHLFPFNSF
DSLEEMRKFLTWFDDEVVPAGFKAADLLHFAYDPGSGNYALSLRAEDYGKVYFYVLEETA
EIYGQWASFEEFLNSFVEE
Download sequence
Identical sequences A0A0F2E0Y9
WP_045615189.1.22862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]