SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2KR97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2KR97
Domain Number 1 Region: 9-144
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.00000942
Family Intein (protein splicing domain) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F2KR97
Sequence length 204
Comment (tr|A0A0F2KR97|A0A0F2KR97_9PROT) Uncharacterized protein {ECO:0000313|EMBL:KJR62869.1} KW=Complete proteome OX=528244 OS=Azospirillum thiophilum. GN=VY88_21735 OC=Rhodospirillaceae; Azospirillum.
Sequence
MAPNPIPTCVLRGTYVRSMFGDVAVESLKIGDLVKSSTRGEFRPIRWIGRRVLAGSSLDT
EQLRQVHLPVRIMRDAIAPGLPARDLYLSPAHALLIGAYGVSARLLINGSSIRQVDEMEE
IEYFHIELDSHDGMFAEGLPVETYFEADNRQAYDNAAEYEALYPGDDPRIQEPCAKIDIP
LATLDRIRANLTERAEQMGLVEAV
Download sequence
Identical sequences A0A0F2KR97
WP_045584155.1.33993 WP_045584155.1.48275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]