SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2KU06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2KU06
Domain Number 1 Region: 14-137
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 3.53e-31
Family CobE/GbiG C-terminal domain-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F2KU06
Sequence length 152
Comment (tr|A0A0F2KU06|A0A0F2KU06_9PROT) Cobalamin biosynthesis protein {ECO:0000313|EMBL:KJR63839.1} KW=Complete proteome OX=528244 OS=Azospirillum thiophilum. GN=VY88_20610 OC=Rhodospirillaceae; Azospirillum.
Sequence
MDGMSSDRILFGPVFVGLGCRRGCGWEEIAALVAGAFDEAALPDAARRLAALAAPAMKSD
EPGLAEAARALGLPQRFIEEDAMLAAQDRVHTRSATVLAAVGLASVAEAAALAAAGPGSR
LLLPRRSTPRATVALALPAVALPGVAVPETRS
Download sequence
Identical sequences A0A0F2KU06
WP_045583867.1.33993 WP_045583867.1.48275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]