SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2LT84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2LT84
Domain Number 1 Region: 7-49,82-214,249-274,358-397
Classification Level Classification E-value
Superfamily WD40 repeat-like 2e-38
Family WD40-repeat 0.00092
Further Details:      
 
Domain Number 2 Region: 258-426,453-470
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000000126
Family YVTN repeat 0.069
Further Details:      
 
Domain Number 3 Region: 536-612
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000693
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F2LT84
Sequence length 644
Comment (tr|A0A0F2LT84|A0A0F2LT84_SPOSC) Coatamer subunit protein {ECO:0000313|EMBL:KJR80064.1} KW=Complete proteome OX=1397361 OS=Sporothrix schenckii 1099-18. GN=SPSK_00473 OC=Sporothrix.
Sequence
MGFCPSSVVCTMTGHNHYVMCAQFHPKEDLVVSASLDQSVRVWDISGLRKKHSAPTSMSF
EDQMARANQNQADMFGNTDAVVKFVLEGHDRGVNWVAFHPTMPLIVSAGDDRLVKLWRMS
ETKAWEVDTCRGHFQNASGCLFHPHQDLILSAGEDKTIRVWDLNKRTAVQTFKRENDRFW
VIAAHPEINLFAAGHDNGVMVFKLERERPASAVYINNLFYINKEKQVRSYDFQKNLESPT
LLSLKKVGPAWVPPRTLSYNPAERSILVTSAADGGSYDLINLPKDGSGALEPTELKRGSG
NSAIFVARNRFAVLNTATQTIDIKDLTNNVTRSFKPPAGTTDIYFGGPGNLLIITPTAVH
LYDIQHKKTIASLNVNGVKYVSWSNDSLYAALLSKHNVTIVTKTLEQVSTLHETIRIKSA
TWDDAGILLYSTLNHIKYTLLNGDNGIVRTLDQTVYLVRVKGRNVYCLDRSAKPKILQID
PTEYRFKMALVKRNYEEMLHIIQTSSLVGQSIISYLQKKGYPEIALQFVQDPTTRFELAI
ECGNLDVAVEMAKELDKPKLWSRLSNEALAHGNNQVVEMCYQKLKQLDKLSFLYLSTGDK
TKLARMAKIAEHRGDFTSRFQNALYLGDVEDRIQMFKEIDLCTY
Download sequence
Identical sequences A0A0F2LT84
XP_016582740.1.8583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]