SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2M1X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2M1X5
Domain Number 1 Region: 13-64,174-255
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.83e-20
Family Regulator of G-protein signaling, RGS 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F2M1X5
Sequence length 370
Comment (tr|A0A0F2M1X5|A0A0F2M1X5_SPOSC) RGS domain protein (Rax1) {ECO:0000313|EMBL:KJR83089.1} KW=Complete proteome OX=1397361 OS=Sporothrix schenckii 1099-18. GN=SPSK_04374 OC=Sporothrix.
Sequence
MADVPGGHTPSPQPDLNRNRLPSLFEVLSRRTLPPVDLYSFYIYMRDQQRSVDYLDFWYV
PVAHPCGLDVAQHMTLCRHYVRELRRSVLVVTPDGEKSASKRSSAILENLGDMTHPVAGP
SKYQSDKERDQDAQMSAFLREDLHPQDSPVSGPGQSPNPASTPRDITDSNSPAHAVARQD
IRASAEKILYTFLLPGAEREIILPGNITTEITTAIEEYGRDDPEVFDVAKDYVFQAMERD
AFPGFLRMKALGNLIPPTLILRLIIGMISMFGAFWTAFVLIFLDESRRTRLFLILPFTFG
VYFLASFQYSLDPVLALLGFSEYTPFHFSRVREPFVRRLLAKRALVVLAVTVLVDAALLV
LFILVPGRRL
Download sequence
Identical sequences A0A0F2M1X5
XP_016585765.1.8583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]