SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2M283 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2M283
Domain Number 1 Region: 581-733
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.83e-29
Family Regulator of G-protein signaling, RGS 0.00082
Further Details:      
 
Domain Number 2 Region: 444-555
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.97e-24
Family DEP domain 0.0068
Further Details:      
 
Domain Number 3 Region: 268-394
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000435
Family PadR-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F2M283
Sequence length 757
Comment (tr|A0A0F2M283|A0A0F2M283_SPOSC) Developmental regulator flbA {ECO:0000313|EMBL:KJR82246.1} KW=Complete proteome OX=1397361 OS=Sporothrix schenckii 1099-18. GN=SPSK_03097 OC=Sporothrix.
Sequence
MAAVSHPSRSEPLSTDNTTSTISDTAPSKFASEREAHRDLTSKYRYSTASNFTVPQTAPE
SRGAESDIASLAANPNVGVTASASGYRPHYSSSPSIVSVQPGPSSKSPRSGSLLAFATAA
IDRTQTALSTAEQKIRPRQSNGRLSVGADSSGVPQFPTYYSLERSPTNASASTASTPQSS
SQNNDHKSETRPPPTVLTATSSDDVSQSAPLSGKPSDHPQHKLSQSYAKPYDQADPTLPL
PIRLPRTDNKMHQTSSRLLRMTDDDRPFTKDFKDLFATLIVSLLPLSAHRVRLTKVEHTF
LSEDAINNLGSLKFSQSNRMPDPKDQSRIVTTTTTTTFSMAKDMARSICQRFLEARFIES
ADGKYQQVYTMKGSVWQLTPKRISILDRFCSRNGIQQKQVGELIGHSTAQIVILERDSQT
DKLVSDRGTIEVIFRRFIGVNGLNVKQSVNAADSDSLSDYRDGMTGVKIASERKVSGKTF
KDTFSGKAAVDWLMDCCTTVDRREASEVASLFSEYGLIEAVQHDRIFQSQVPGSHLFQPT
KNAIFQLTTKGRDLFNGNISRGRSSESDGGTAPRPGIARDSNTQRLDKILNDAALRLLFR
ENLRETHCEENLSFYLDVDDFVRSCRQSIRLAQKNPGTTSMDGIKEIMAQAYGIYNAFLA
PGSPCELNIDHQLRNNLATRMTKAVGQDTAMIDTLHEVTTLFEDAQNAVFKLMASDSVPK
FLRHPKYEHTLRNYDFDAIVIGGNRMPERSQSRSNRK
Download sequence
Identical sequences A0A0F2M283
XP_016584922.1.8583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]