SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2MJG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2MJG0
Domain Number 1 Region: 1167-1278
Classification Level Classification E-value
Superfamily PX domain 2.09e-23
Family PX domain 0.00082
Further Details:      
 
Domain Number 2 Region: 543-701
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-18
Family Regulator of G-protein signaling, RGS 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2MJG0
Sequence length 1527
Comment (tr|A0A0F2MJG0|A0A0F2MJG0_SPOSC) tRNA (Guanine-N7-)-methyltransferase {ECO:0000313|EMBL:KJR89843.1} KW=Complete proteome OX=1397361 OS=Sporothrix schenckii 1099-18. GN=SPSK_05821 OC=Sporothrix.
Sequence
MALRARDVVLAGVAGFVAWGYATHWFPAIRFAGHGVVAGALLSCAGLLAFVVTVRIPIYA
PEATTTARATITTLTSTRRTPTAAFVSPAHWTQERAALRASLVYHPVPLYPAMPRVSAAL
DSILSGILRDNVRSWYAHISAPGPLQNPTFPNNVDATVRVALGHLRDRLLGVDDVVEVLT
SRLVPLLTAHFHDFNEAERAVRGRKLNRSVTESDELDLAIAAKYREIRAAAGATEGRNET
KDGLHPAAQLSYSEASTRLVQQDYLRKLVGDRLLPKLLPAPFLASRPVAALVREIVACAV
LYPLLQLLADPDTYNQLMENYGRTMLQDRSTVRRLRAALDQHASSSGAVLKSGGSGGRSS
SPLSAAAAALAGGAGASGGRAAPPAAFPRLVPGDSERRFERFVRSIRKTNILSDARRFRS
EVASQLKRDSQQQIQDLHSGTGSHNSNPEMTVYLRRLEMSKRLLDQKVQYLAAGGDSKHG
TIHATGGANSHALGGNDSSGGPGTPAGLGSGGGVGGGGGGAGAGGPGSHPLSFAGPMAPT
VSRLETASLADLLRDASALSYFMEYMDRQRLMPLVQFWLVVDGLRNPLEEVDEEEDDDDE
LDTSVDDTPASLAPWTEADRLDIAQIDQAYLAQPALHISEASRRTVRVFLEAGPAATPEQ
YYRARRAILRAQMAVLNEMKDKHFQGFKKSDLFYKCLATEDAAQQRQQQQQQQQQQQQQQ
QQQQMQRSVSPLTVVPISQAHSSGTATPNKPLPPNPASRLLRGAQATTGNGTAGTGVGAG
SGNGMAPTRRAGSATDLRTTGTTLTNPAANSSLMTQDDSLFSRRSLDGVSNSAINSNNSS
TPLFGDDDDFFTTPRSSAGRNSNSGLANSTGNLAAPPAPDPMADSVQSLGGGDPNVPDTE
VVQAVEQALTTIMEDKRPTTAEDLRASLFGDDDGEADRSSTPDKGSIFSGIDVDGSTSST
KKVRDEPRRGSTPQLSQAPGPGAGHVHPNPHAHALLLHGDNSGKPSLASLGLVSAASRIG
VFEDDDLFGDDQAKYMSDDEGDGGSDMAGSGLLEGPSAKDRDLSKDGGAGDSDEGGVHEA
APGDLGLVEAIAALSDDIDRLGAQDAVVNSLLKKAELTNNTAELRILRKSKASLQREIRR
KELQRQQYALQETDNSLYGRANVRLTSVQSGREEDTGKEYAQYVIEVRRDADMATSGTAT
VSWTVVRRYSAFWELHQRLRGRYPSVRALDFPRRRVVLNKLQGDFLQKRRAALERYLRAL
LLMPDVCRSRELRAFLSQRVISTHVNGGASASGGTNVPASVGNLDADRRDVISRLYDSVA
DGMEDILGSIPVLDQLSTAGQNLIAAAASQLGGGAAAHNAAAAQNASASGAAAAAASAEA
AAELAAATSTLPDETAAPFVKPICDIFLEIFELNRGNNWLRGRAVVVVLHQLLGGTIERK
LRENVRTHLQEEEALLKYLGLVQDALFPADGIKKPPRTPAQKARTRNEAGLMLATLVPDL
AGSVVGRLNAQAASRRIFATFNNSRLK
Download sequence
Identical sequences A0A0F2MJG0
XP_016592519.1.8583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]