SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2P2G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2P2G2
Domain Number 1 Region: 21-157
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000157
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2P2G2
Sequence length 180
Comment (tr|A0A0F2P2G2|A0A0F2P2G2_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:KJS08448.1} KW=Complete proteome; Reference proteome OX=1629712 OS=Hoeflea sp. BRH_c9. GN=VR78_18115 OC=Phyllobacteriaceae; Hoeflea.
Sequence
MERLILPVDGKWEDVGDPGPAIEAWEQRTGRRLPDDYRAFMRKFNGGRPFPLMFRYQIPL
EIYPSDEPVTFLDPLYGWNYVEEIWDQKVFSAATPPDMIFIGADPGGLELLLSVRPEDHG
RIYAWLHSLDAWGHGGNTRIWPQAASFRAFIESLFENDAGDGDAYWRLPGQEPLERRFDF
Download sequence
Identical sequences A0A0F2P2G2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]