SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2Q1I4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2Q1I4
Domain Number 1 Region: 190-288
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000126
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2Q1I4
Sequence length 291
Comment (tr|A0A0F2Q1I4|A0A0F2Q1I4_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:KJS18757.1} KW=Complete proteome; Reference proteome OX=1629719 OS=Clostridiaceae bacterium BRH_c20a. GN=VR72_21300 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae.
Sequence
MNISNAITELEQELISKHNNKLIADNNELLTELVDLKSKLFSAKKQEDFDAFLIKVNEKE
NTILKEVLTNEQKALYDTLTKEYSVIISDKMMELNLLSNTEYNRTAVKDFKFVFDEIRDN
EAKYKNSQSQLFTLVSKRLFSYDPAKLFNETLIYYNHVYSFIFSKLDYTEFINAVIKQEA
RNTFERSGDINLELPKELVPFYSQYVPVDVEIVLNDLTSVKLYPANRLKSLQNEYNLGDK
YFVFATRESDPIAIMDGKIVTCAHGSKLPQIEIIASNFDAYIHELLNAMKI
Download sequence
Identical sequences A0A0F2Q1I4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]