SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2RNT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2RNT6
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 5.23e-55
Family Obg GTP-binding protein N-terminal domain 0.00000307
Further Details:      
 
Domain Number 2 Region: 150-329
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.36e-48
Family G proteins 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F2RNT6
Sequence length 346
Comment (tr|A0A0F2RNT6|A0A0F2RNT6_9RHOB) GTP-binding protein Obg {ECO:0000256|HAMAP-Rule:MF_01454} KW=Complete proteome; Reference proteome OX=1629710 OS=Hyphomonas sp. BRH_c22. GN=VR74_01245 OC=Hyphomonadaceae; Hyphomonas.
Sequence
MKFLDQAKVYIKSGGGGAGCVSFRREKYVEYGGPDGGDGGRGGDVWAEAVDGLNTLIDYR
YQQHHKAKRGGHGMGKQRTGAKGDDVTLKLPVGTQIFEDDQETLIADLTEVGQRVLLATG
GNGGWGNLRFKSSTNQAPRRANAGEEGEERWLWLRLKLIADAGLVGLPNAGKSTFLSAVT
AANPKIADYPFTTLDPGLGVVDLGPNTRFVLADIPGLIEGAAEGAGLGHRFLGHIERCKV
LLHLIDCTQDNPAEAYRTIRKELEDYSPELAERPEIVGLNKIDALNPELVAEQVKQLKKA
YKGKPLLISGVTGAGVRDALFAIVKHLGLQAEAEADGVDEDGSWSP
Download sequence
Identical sequences A0A0F2RNT6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]