SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2SED5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2SED5
Domain Number 1 Region: 42-231
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 6.8e-55
Family CbiG N-terminal domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 217-347
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 1.57e-36
Family CobE/GbiG C-terminal domain-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2SED5
Sequence length 350
Comment (tr|A0A0F2SED5|A0A0F2SED5_9FIRM) Cobalamin biosynthesis protein CbiG {ECO:0000313|EMBL:KJS48465.1} KW=Complete proteome; Reference proteome OX=1629714 OS=Peptococcaceae bacterium BRH_c23. GN=VR66_13955 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Peptococcaceae.
Sequence
MDTIQRIGEGLPNTVLQKVYIHEKVLGQTKNQGEAQKHELQLQIFTRLRDIVPRLWQEYS
VLIFVMATGIVVRQIASLIEGKDRDPAVLVLDEAGKFVIPLLSGHLGGANAWAHQISAQL
GALPVITTATDVRGMVAPDEYARRYGWKVEPIDHLPAVNRLLLEQNRLNVWASYPLKSEH
HTWVSDPHYHFLSEKEKDQANVIIDAFPHSSLKVDCLYLVPPILSVGVGCRRGVSSEVIL
ERIRTSVEQLGASLKAISGIYSVDLKSDEVGLIEAAKYLRVPFQTYRADELQAVNLQEQL
SRSNFVREKIGVDGVCEAASLLGAKRGRLVLPKTKGQGVTVAISIENFLS
Download sequence
Identical sequences A0A0F2SED5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]