SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2T685 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2T685
Domain Number 1 Region: 25-174
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.01e-24
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F2T685
Sequence length 177
Comment (tr|A0A0F2T685|A0A0F2T685_9ACTN) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KJS58713.1} KW=Complete proteome; Reference proteome OX=359131 OS=Streptomyces rubellomurinus. GN=VM95_31520 OC=Streptomyces.
Sequence
MGHFEGFDVDGFWDDSAYALEAYVEEAPPSRELIEALEEELGGYRLPDSYIALMTVHNGG
TPTRTCFPMPEATDRADDYIEITGIRGIGRTRSQSLGGEFGSLFWIEMWEYPDIGVYFAD
TPSAGHDMLALDYRACGRHGEPTVVHVDQENGFAITLVAESFEAFVTGLVHESVYDT
Download sequence
Identical sequences A0A0F2T685
WP_045703298.1.5407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]