SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F2T6C1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F2T6C1
Domain Number 1 Region: 168-307
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000017
Family SMI1/KNR4-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F2T6C1
Sequence length 333
Comment (tr|A0A0F2T6C1|A0A0F2T6C1_9ACTN) Cell wall assembly protein Knr4 {ECO:0000313|EMBL:KJS57885.1} KW=Complete proteome; Reference proteome OX=359131 OS=Streptomyces rubellomurinus. GN=VM95_36875 OC=Streptomyces.
Sequence
MTTGRPGVAAAPNAAYAGQVVQFPDPVRAERHPAGVRVDEYGYPDFSPYAAAAAEVADPP
EGFGVDELRLTDYVSANAALFIEGHPLWADLDTAVATPPGWTWHHVVGRAAPGWRRMELV
PVEVKALLRHHGGLATSAADHSRRGTRPLQEHRPVHFSLARDGGDPVGVPEDLVQRAEER
LGYRLPGAYRTFLKVAGGRAPVGLALDTDLGLLLDQPFLTLSEEYGTDDVVYANKCLRDH
LTKDYLGIAYAQGGIVALKVRGERAGSVWLHLYDDARDTGAPEAPEDRCARLLLPCGDDF
DAFLLRLAGSPPELETVAKLMVDGGFARAVPVG
Download sequence
Identical sequences A0A0F2SWP9 A0A0F2T6C1
WP_045705562.1.5407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]