SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F3FQ78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F3FQ78
Domain Number 1 Region: 4-146
Classification Level Classification E-value
Superfamily Ferritin-like 3.33e-38
Family Ferritin 0.0000788
Further Details:      
 
Domain Number 2 Region: 154-189
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.000000000208
Family Rubredoxin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F3FQ78
Sequence length 204
Comment (tr|A0A0F3FQ78|A0A0F3FQ78_9CLOT) Rubrerythrin {ECO:0000313|EMBL:KJU71849.1} KW=Complete proteome OX=1561 OS=Clostridium baratii. GN=UC77_06600 OC=Clostridium.
Sequence
MKSLKGSKTADNLAKAFAGESQARNRYTFYSRIAAKEGHKQIEAVFLETADNERAHAKVF
YDLLVEGLGHTDITVNADYPIGLGTTLDNLKYAAEGERDEWGTAYPEFAKIAKEEGYPEV
YNAFSQILSVEKHHEQRYLDLYANLKDNLLYVSETPQYWKCRNCGYIFEGTEAPKKCPAC
YHPQGFFEIAYDTKAYGSSKEHAK
Download sequence
Identical sequences A0A0F3FQ78
WP_045725046.1.56158 WP_045725046.1.80764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]