SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F3H3G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F3H3G2
Domain Number 1 Region: 9-139
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000183
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F3H3G2
Sequence length 139
Comment (tr|A0A0F3H3G2|A0A0F3H3G2_STRPA) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KJU88711.1} KW=Complete proteome OX=1318 OS=Streptococcus parasanguinis. GN=TZ97_00417 OC=Streptococcus.
Sequence
MFRMLDEDSPISKEDLLQFEEILGKKLPKTMLDFYLKHNGGQPQVMGVHDEHHLFPFNSF
NSLEEMSKSLTWFDDEEVPAGFKATDLLHFAYDPGSGNYALSLREEDYGMVYFYVLEEKA
EIYGQWASFEKFLNSFVEE
Download sequence
Identical sequences A0A0F3H3G2
WP_045759211.1.76178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]