SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F3H844 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F3H844
Domain Number 1 Region: 9-139
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000262
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F3H844
Sequence length 139
Comment (tr|A0A0F3H844|A0A0F3H844_9STRE) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KJU90295.1} KW=Complete proteome OX=68892 OS=Streptococcus infantis. GN=TZ96_01757 OC=Streptococcus.
Sequence
MFRMLDEDSPISKEDFLQFEEILGKKLPKTMLGFYLKHNGGQPQVRGVHDDRHLFPFNSF
NSLEEMKKSLTWFDDEAVPEGFKGADLLHFAYDPGSGNYALSLREEDFGKVYFYVLEETA
ELYGQWPSFEEFLNSFVEE
Download sequence
Identical sequences A0A0F3H844
WP_045763767.1.50767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]