SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F3MV09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F3MV09
Domain Number 1 Region: 20-201
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000000549
Family Pseudo ankyrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F3MV09
Sequence length 215
Comment (tr|A0A0F3MV09|A0A0F3MV09_RICFI) Ankyrin repeat family protein {ECO:0000313|EMBL:KJV59287.1} KW=Complete proteome OX=1359196 OS=Rickettsia felis str. Pedreira. GN=RFEPED_1692 OC=Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
Sequence
MPLSNNQKFYIAETVEEKALCNAVRNSNVNEALSLILKLIEANQFQKFNGDLRDRDPEET
YYEVYYPLLSVAVLKRNFKMFEMLLEYGFKPHAISSGLNPETTPLIEASRCGRGDMVLKL
TSILNKDELNYYDKDIKNSALYYAIKNNHVNIFNVLTSMTKGVDVDFEVSMEVTIISSNF
NLFIHFFYNALQGIQDEVLRKGYLLQCAASKKIYK
Download sequence
Identical sequences A0A0F3MV09 Q4ULD9
WP_011271112.1.40963 WP_011271112.1.65220 315456.RF_0783 gi|67459175|ref|YP_246799.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]