SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F3QGE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F3QGE4
Domain Number 1 Region: 87-281
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000536
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F3QGE4
Sequence length 350
Comment (tr|A0A0F3QGE4|A0A0F3QGE4_RICBE) Uncharacterized protein {ECO:0000313|EMBL:KJV91598.1} KW=Complete proteome OX=1359194 OS=Rickettsia bellii str. RML Mogi. GN=RBEMOGI_0204 OC=Rickettsiaceae; Rickettsieae; Rickettsia; belli group.
Sequence
MFDHTSIKKMDLVTFSEFLQIQYKNVVKFYTELQQQYSNKYQELIPEYDFPKIISYLPEK
LKSAFNIVLNEHYHSLTKSEMKHLLKIDNSYISIILDKAIKEFDLNTVELILDSIEINNL
HILSAISASNTLPSNQSIQIFEMVYAKIKNADYNILLLFAINAENLSVAEFLLDKIQIQT
FHLISAIQKANPNIVKILLNKVENIDNLVLNEANKLGSPLIFKLVLNKMVENNSLVLADI
IKTATPYFIKLALDKMKKVNQEDLVEAIKLGDQNILKLILNKIENPHTEIFTNDRGIIKQ
MEEVINSPFSDNAISIIKTAYSIENQEIIDLGFNNTPELLGEDFCAPTAE
Download sequence
Identical sequences A0A0F3QGE4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]