SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F3QK81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F3QK81
Domain Number 1 Region: 32-154
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.000000000051
Family HEPN domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F3QK81
Sequence length 161
Comment (tr|A0A0F3QK81|A0A0F3QK81_RICAM) HEPN domain protein {ECO:0000313|EMBL:KJV93015.1} KW=Complete proteome OX=1359166 OS=Rickettsia amblyommatis str. Darkwater. GN=RAMDARK_0984 OC=Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
Sequence
MLLYDSKECTLSEAKDFPWSEMQEIAKDYYEEWFRSGFGFLIDCKYPFERGELNKSAFYL
HQATESFYSSILLVFANYKPKLHDIEELGSMAENYNSELLQVFPIATPEQKECFELLQKA
YVDARYDKNYKITKEQLLYLIDRVEKLKAITERICTARINQ
Download sequence
Identical sequences A0A0F3N2P3 A0A0F3QK81

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]