SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F3QKA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0F3QKA6
Domain Number - Region: 22-60
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0494
Family Cytochrome c oxidase Subunit F 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F3QKA6
Sequence length 63
Comment (tr|A0A0F3QKA6|A0A0F3QKA6_RICBE) Zinc-finger domain protein {ECO:0000313|EMBL:KJV92561.1} KW=Complete proteome OX=1359194 OS=Rickettsia bellii str. RML Mogi. GN=RBEMOGI_1195 OC=Rickettsiaceae; Rickettsieae; Rickettsia; belli group.
Sequence
MLDVTKRKMCKSMEIVNSVDASVSCCGKEPPYDHPRVYLEIDKEKKEVSCLYCSKKFRLI
EPK
Download sequence
Identical sequences A0A0F3QGL2 A0A0F3QKA6 Q1RGP7
gi|157827811|ref|YP_001496875.1| 336407.RBE_1386 391896.A1I_07700 gi|91206201|ref|YP_538556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]